PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn208081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 264aa    MW: 30357.2 Da    PI: 7.2502
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn208081genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.7e-14102146347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E++l++ + +++G+g+W++I+r+   ++t+ q+ s+ qk+
       Achn208081 102 PWTEQEHQLFLMGLNKYGKGDWRSISRYYVVTKTPTQVASHAQKF 146
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.441153IPR017884SANT domain
SMARTSM007170.0018251IPR001005SANT/Myb domain
CDDcd001671.13E-7245No hitNo description
SuperFamilySSF466891.0E-7354IPR009057Homeodomain-like
PROSITE profilePS5129419.82795151IPR017930Myb domain
SuperFamilySSF466893.52E-1696152IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-1798150IPR006447Myb domain, plants
SMARTSM007171.1E-1199149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-10101143IPR009057Homeodomain-like
PfamPF002497.0E-12102145IPR001005SANT/Myb domain
CDDcd001673.00E-10102147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MEWTFEENKV FENALAEFGL NSPAFFEHVA SKLPYKSMEQ IKRHYDCLIE DVEMIESDLF  60
PTPKYESPEE SIQGDVETKS EKACAKQARK AVSGHQRKRG VPWTEQEHQL FLMGLNKYGK  120
GDWRSISRYY VVTKTPTQVA SHAQKFFRRQ TSTTPTDRRR PSIHDIQTVN STFFSVPQKH  180
KSPILTNELQ TLDVVPLPNP YDLIPMYNHT FPNNDLTNFS NEIPVLPPGT STFPMVMNSF  240
FNYPSGVYPC SSSYPIPYPR NYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098014.15e-91PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-52DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A022RKM88e-82A0A022RKM8_ERYGU; Uncharacterized protein
STRINGAT5G08520.11e-53(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52342032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.15e-51MYB family protein